Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.42: Arginase/deacetylase [52767] (1 superfamily) 3 layers: a/b/a, parallel beta-sheet of 8 strands, order 21387456 |
Superfamily c.42.1: Arginase/deacetylase [52768] (3 families) |
Family c.42.1.1: Arginase-like amidino hydrolases [52769] (5 proteins) Pfam PF00491 |
Protein Agmatinase [110585] (1 species) |
Species Deinococcus radiodurans [TaxId:1299] [110586] (3 PDB entries) Uniprot Q9RZ04 # DRA0149 |
Domain d1wohc1: 1woh C:3-304 [109448] Other proteins in same PDB: d1woha2, d1wohb2, d1wohc2, d1wohd2, d1wohe2, d1wohf2 |
PDB Entry: 1woh (more details), 1.75 Å
SCOPe Domain Sequences for d1wohc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wohc1 c.42.1.1 (C:3-304) Agmatinase {Deinococcus radiodurans [TaxId: 1299]} gpahlpyggiptfaraplvqpdgdwqadvaalgvpfdialgfrpgarfapralreaslrs vppftgldgktrlqgvtfadagdvilpslepqlahdriteaarqvrgrcrvpvflggdhs vsypllrafadvpdlhvvqldahldftdtrndtkwsnsspfrracealpnlvhittvglr glrfdpeavaaararghtiipmddvtadlagvlaqlprgqnvyfsvdvdgfdpavipgts spepdgltyaqgmkilaaaaanntvvgldlvelapnldptgrsellmarlvmetlcevfd hv
Timeline for d1wohc1: