Lineage for d1w3nb_ (1w3n B:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 817252Superfamily c.1.10: Aldolase [51569] (8 families) (S)
    Common fold covers whole protein structure
  5. 817253Family c.1.10.1: Class I aldolase [51570] (12 proteins)
    the catalytic lysine forms schiff-base intermediate with substrate
    possible link between the aldolase superfamily and the phosphate-binding beta/alpha barrels
  6. 817254Protein 2-keto-3-deoxy gluconate aldolase Eda [110360] (1 species)
  7. 817255Species Sulfolobus solfataricus [TaxId:2287] [110361] (4 PDB entries)
    Uniprot Q97U28
  8. 817269Domain d1w3nb_: 1w3n B: [109161]

Details for d1w3nb_

PDB Entry: 1w3n (more details), 2.1 Å

PDB Description: sulfolobus solfataricus 2-keto-3-deoxygluconate (kdg) aldolase complex with d-kdg
PDB Compounds: (B:) 2-keto-3-deoxy gluconate aldolase

SCOP Domain Sequences for d1w3nb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w3nb_ c.1.10.1 (B:) 2-keto-3-deoxy gluconate aldolase Eda {Sulfolobus solfataricus [TaxId: 2287]}
peiitpiitpftkdnridkeklkihaenlirkgidklfvngttglgpslspeeklenlka
vydvtnkiifqvgglnlddairlaklskdfdivgiasyapyyyprmsekhlvkyfktlce
vsphpvylynyptatgkdidakvakeigcftgvkdtieniihtldykrlnpnmlvysgsd
mliatvastgldgnvaagsnylpevtvtikklamerkidealklqflhdevieasrifgs
lssnyvltkyfqgydlgyprppifplddeeerqlikkvegiraklvelkilke

SCOP Domain Coordinates for d1w3nb_:

Click to download the PDB-style file with coordinates for d1w3nb_.
(The format of our PDB-style files is described here.)

Timeline for d1w3nb_: