Lineage for d1w3da_ (1w3d A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2310709Fold a.9: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47004] (1 superfamily)
    3 helices; bundle, closed, right-handed twist; up-and-down
  4. 2310710Superfamily a.9.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47005] (2 families) (S)
  5. 2310711Family a.9.1.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47006] (4 proteins)
  6. 2310720Protein E3/E1 binding domain of dihydrolipoyl acetyltransferase [47011] (1 species)
  7. 2310721Species Bacillus stearothermophilus [TaxId:1422] [47012] (5 PDB entries)
    Uniprot P11961 118-170
    Uniprot Q8VV74 128-169
  8. 2310727Domain d1w3da_: 1w3d A: [109151]

Details for d1w3da_

PDB Entry: 1w3d (more details)

PDB Description: nmr structure of the peripheral-subunit binding domain of bacillus stearothermophilus e2p
PDB Compounds: (A:) dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase

SCOPe Domain Sequences for d1w3da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w3da_ a.9.1.1 (A:) E3/E1 binding domain of dihydrolipoyl acetyltransferase {Bacillus stearothermophilus [TaxId: 1422]}
nrrviampsvrkyarekgvdirlvqgtgkngrvlkedidaflagga

SCOPe Domain Coordinates for d1w3da_:

Click to download the PDB-style file with coordinates for d1w3da_.
(The format of our PDB-style files is described here.)

Timeline for d1w3da_: