Lineage for d1w1ih_ (1w1i H:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1341467Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 1341468Family c.1.9.1: Adenosine/AMP deaminase [51557] (3 proteins)
  6. 1341469Protein Adenosine deaminase (ADA) [51558] (4 species)
    Common fold covers the whole protein structure
  7. 1341470Species Cow (Bos taurus) [TaxId:9913] [82257] (12 PDB entries)
    Uniprot P56658 3-350 ! Uniprot P56658
  8. 1341484Domain d1w1ih_: 1w1i H: [109054]
    Other proteins in same PDB: d1w1ia1, d1w1ia2, d1w1ib1, d1w1ib2, d1w1ic1, d1w1ic2, d1w1id1, d1w1id2
    complexed with nag, ndg, zn

Details for d1w1ih_

PDB Entry: 1w1i (more details), 3.03 Å

PDB Description: crystal structure of dipeptidyl peptidase iv (dppiv or cd26) in complex with adenosine deaminase
PDB Compounds: (H:) adenosine deaminase

SCOPe Domain Sequences for d1w1ih_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w1ih_ c.1.9.1 (H:) Adenosine deaminase (ADA) {Cow (Bos taurus) [TaxId: 9913]}
tpafdkpkvelhvhldgaikpetilyygkrrgialpadtpeellniigmdkpltlpdfla
kfdyympaiagcrdaikriayefvemkakdgvvyvevrysphllanskvepipwnqaegd
ltpdevvslvnqglqegerdfgvkvrsilccmrhqpswssevvelckkyreqtvvaidla
gdetiegsslfpghvqayaeavksgvhrtvhagevgsanvvkeavdtlkterlghgyhtl
edttlynrlrqenmhfeicpwssyltgawkpdtehavirfkndqvnyslntddplifkst
ldtdyqmtkkdmgfteeefkrlninaakssflpedekkelldllykayrmps

SCOPe Domain Coordinates for d1w1ih_:

Click to download the PDB-style file with coordinates for d1w1ih_.
(The format of our PDB-style files is described here.)

Timeline for d1w1ih_: