Lineage for d1w0jf2 (1w0j F:9-81)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 803679Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (3 superfamilies)
    barrel, closed; n=6, S=8; greek-key
  4. 803680Superfamily b.49.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50615] (1 family) (S)
  5. 803681Family b.49.1.1: N-terminal domain of alpha and beta subunits of F1 ATP synthase [50616] (2 proteins)
    6 domains form a ring structure which contains a barrel, closed; n=24, S=24(?)
  6. 803734Protein F1 ATP synthase beta subunit, domain 1 [88677] (4 species)
  7. 803737Species Cow (Bos taurus) [TaxId:9913] [88678] (12 PDB entries)
    Uniprot P00829
  8. 803740Domain d1w0jf2: 1w0j F:9-81 [109005]
    Other proteins in same PDB: d1w0ja1, d1w0ja2, d1w0ja3, d1w0jb1, d1w0jb2, d1w0jb3, d1w0jc1, d1w0jc2, d1w0jc3, d1w0jd1, d1w0jd3, d1w0je1, d1w0je3, d1w0jf1, d1w0jf3, d1w0jg_
    complexed with adp, bef, gol, mo3, mo4, po4

Details for d1w0jf2

PDB Entry: 1w0j (more details), 2.2 Å

PDB Description: Beryllium fluoride inhibited bovine F1-ATPase
PDB Compounds: (F:) ATP synthase beta chain, mitochondrial precursor

SCOP Domain Sequences for d1w0jf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w0jf2 b.49.1.1 (F:9-81) F1 ATP synthase beta subunit, domain 1 {Cow (Bos taurus) [TaxId: 9913]}
ttgrivavigavvdvqfdeglppilnalevqgretrlvlevaqhlgestvrtiamdgteg
lvrgqkvldsgap

SCOP Domain Coordinates for d1w0jf2:

Click to download the PDB-style file with coordinates for d1w0jf2.
(The format of our PDB-style files is described here.)

Timeline for d1w0jf2: