Lineage for d1vlft1 (1vlf T:196-274)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2378393Fold b.3: Prealbumin-like [49451] (8 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 2379615Superfamily b.3.5: Cna protein B-type domain [49478] (2 families) (S)
  5. 2379616Family b.3.5.1: Cna protein B-type domain [49479] (4 proteins)
    Pfam PF05738
  6. 2379636Protein Transhydroxylase beta subunit, BthL, C-terminal domain [110094] (1 species)
    the penultimate strand is in the other beta-sheet than in the Cna repeats
  7. 2379637Species Pelobacter acidigallici [TaxId:35816] [110095] (6 PDB entries)
    Uniprot P80564
  8. 2379641Domain d1vlft1: 1vlf T:196-274 [108806]
    Other proteins in same PDB: d1vlfm1, d1vlfm2, d1vlfn2, d1vlfo1, d1vlfo2, d1vlfp2, d1vlfq1, d1vlfq2, d1vlfr2, d1vlfs1, d1vlfs2, d1vlft2, d1vlfu1, d1vlfu2, d1vlfv2, d1vlfw1, d1vlfw2, d1vlfx2
    complexed with 4mo, btt, ca, mgd, sf4
    complexed with 4mo, btt, ca, mgd, sf4

Details for d1vlft1

PDB Entry: 1vlf (more details), 2 Å

PDB Description: Crystal Structure of Pyrogallol-Phloroglucinol Transhydroxylase from Pelobacter acidigallici complexed with inhibitor 1,2,4,5-tetrahydroxy-benzene
PDB Compounds: (T:) Pyrogallol hydroxytransferase small subunit

SCOPe Domain Sequences for d1vlft1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vlft1 b.3.5.1 (T:196-274) Transhydroxylase beta subunit, BthL, C-terminal domain {Pelobacter acidigallici [TaxId: 35816]}
knyvtagilvqgdcfegakvvlksggkevasaetnffgefkfdaldngeytveidadgks
ysdtvviddksvdlgfikl

SCOPe Domain Coordinates for d1vlft1:

Click to download the PDB-style file with coordinates for d1vlft1.
(The format of our PDB-style files is described here.)

Timeline for d1vlft1: