Class b: All beta proteins [48724] (149 folds) |
Fold b.3: Prealbumin-like [49451] (7 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.5: Cna protein B-type domain [49478] (1 family) |
Family b.3.5.1: Cna protein B-type domain [49479] (2 proteins) Pfam 05738 |
Protein Transhydroxylase beta subunit, BthL, C-terminal domain [110094] (1 species) the penultimate strand is in the other beta-sheet than in the Cna repeats |
Species Pelobacter acidigallici [TaxId:35816] [110095] (6 PDB entries) |
Domain d1vlfn1: 1vlf N:196-274 [108794] Other proteins in same PDB: d1vlfm1, d1vlfm2, d1vlfn2, d1vlfo1, d1vlfo2, d1vlfp2, d1vlfq1, d1vlfq2, d1vlfr2, d1vlfs1, d1vlfs2, d1vlft2, d1vlfu1, d1vlfu2, d1vlfv2, d1vlfw1, d1vlfw2, d1vlfx2 |
PDB Entry: 1vlf (more details), 2 Å
SCOP Domain Sequences for d1vlfn1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vlfn1 b.3.5.1 (N:196-274) Transhydroxylase beta subunit, BthL, C-terminal domain {Pelobacter acidigallici} knyvtagilvqgdcfegakvvlksggkevasaetnffgefkfdaldngeytveidadgks ysdtvviddksvdlgfikl
Timeline for d1vlfn1: