Class b: All beta proteins [48724] (178 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.7: Metal cation-transporting ATPase, actuator domain A [81653] (1 family) a distorted variant of double-helix |
Family b.82.7.1: Metal cation-transporting ATPase, actuator domain A [81652] (2 proteins) |
Protein Calcium ATPase, transduction domain A [81651] (1 species) |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [81650] (43 PDB entries) Uniprot P04191 |
Domain d1vfpa1: 1vfp A:125-239 [108576] Other proteins in same PDB: d1vfpa2, d1vfpa3, d1vfpa4, d1vfpb2, d1vfpb3, d1vfpb4 complexed with acp, ca, mg |
PDB Entry: 1vfp (more details), 2.9 Å
SCOPe Domain Sequences for d1vfpa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1vfpa1 b.82.7.1 (A:125-239) Calcium ATPase, transduction domain A {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} emgkvyradrksvqrikardivpgdivevavgdkvpadirilsiksttlrvdqsiltges vsvikhtepvpdpravnqdkknmlfsgtniaagkalgivattgvsteigkirdqm
Timeline for d1vfpa1:
View in 3D Domains from other chains: (mouse over for more information) d1vfpb1, d1vfpb2, d1vfpb3, d1vfpb4 |