Lineage for d1vdla_ (1vdl A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1260917Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 1260941Superfamily a.5.2: UBA-like [46934] (4 families) (S)
  5. 1260942Family a.5.2.1: UBA domain [46935] (25 proteins)
  6. 1261025Protein Ubiquitin carboxyl-terminal hydrolase 25 [109721] (1 species)
  7. 1261026Species Mouse (Mus musculus) [TaxId:10090] [109722] (1 PDB entry)
    Uniprot P57080 1-67
  8. 1261027Domain d1vdla_: 1vdl A: [108528]
    Structural genomics target

Details for d1vdla_

PDB Entry: 1vdl (more details)

PDB Description: solution structure of rsgi ruh-013, a uba domain in mouse cdna
PDB Compounds: (A:) Ubiquitin carboxyl-terminal hydrolase 25

SCOPe Domain Sequences for d1vdla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vdla_ a.5.2.1 (A:) Ubiquitin carboxyl-terminal hydrolase 25 {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgmtveqnvlqqsaaqkhqqtflnqlreitgindaqilqqalkdsngnlelavaf
ltaknaktppqeetsgpssg

SCOPe Domain Coordinates for d1vdla_:

Click to download the PDB-style file with coordinates for d1vdla_.
(The format of our PDB-style files is described here.)

Timeline for d1vdla_: