Lineage for d1vclb2 (1vcl B:151-283)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1543030Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 1543418Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) (S)
  5. 1543419Family b.42.2.1: Ricin B-like [50371] (11 proteins)
  6. 1543473Protein Hemolytic lectin CEL-III, domains 1 and 2 [110211] (1 species)
  7. 1543474Species Cucumaria echinata [TaxId:40245] [110212] (4 PDB entries)
    Uniprot Q868M7 11-442
  8. 1543478Domain d1vclb2: 1vcl B:151-283 [108502]
    Other proteins in same PDB: d1vcla3, d1vclb3
    complexed with btb, ca, cl, mg

Details for d1vclb2

PDB Entry: 1vcl (more details), 1.7 Å

PDB Description: crystal structure of hemolytic lectin cel-iii
PDB Compounds: (B:) hemolytic lectin CEL-III

SCOPe Domain Sequences for d1vclb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1vclb2 b.42.2.1 (B:151-283) Hemolytic lectin CEL-III, domains 1 and 2 {Cucumaria echinata [TaxId: 40245]}
pelfygrlrneksdlcldvegsdgkgnvlmyscednldqwfryyengeivnaksgmcldv
egsdgsgnvgiyrcddlrdqmwsrpnaycngdycsflnkesnkcldvsgdqgtgdvgtwq
cdglpdqrfkwvf

SCOPe Domain Coordinates for d1vclb2:

Click to download the PDB-style file with coordinates for d1vclb2.
(The format of our PDB-style files is described here.)

Timeline for d1vclb2: