SCOP 1.75: Domain d1ulje2: 1ulj E:171-451

Lineage for d1ulje2 (1ulj E:171-451)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (10 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain [55969] (6 proteins)
   Pfam PF00848; contains a few insertion and C-terminal extension compared with Bet v1

6. Protein Biphenyl dioxygenase large subunit BphA1, C-terminal domain [111166] (1 species)

7. Species Rhodococcus sp. (strain RHA1) [TaxId:101510] [111167] (2 PDB entries)
   Uniprot Q53122 17-451

8. Domain d1ulje2: 1ulj E:171-451 [107937]
   Other proteins in same PDB: d1ulja1, d1uljb_, d1uljc1, d1uljd_, d1ulje1, d1uljf_
   complexed with bnl, fe2, fes

Details for d1ulje2

PDB Entry: 1ulj, 2.6 Å

PDB Description: Biphenyl dioxygenase (BphA1A2) in complex with the substrate

PDB Compounds: (E:) biphenyl dioxygenase large subunit

SCOP Domain Sequences for d1ulje2:

Sequence, based on SEQRES records:

>d1ulje2 d.129.3.3 (E:171-451) Biphenyl dioxygenase large subunit BphA1, C-terminal domain {Rhodococcus sp. (strain RHA1) [TaxId: 101510]}
apdldtylgeakfymdhmldrteagteaipgiqkwvipcnwkfaaeqfcsdmyhagttsh
lsgilaglpdgvdlselapptegiqyratwgghgsgfyigdpnlllaimgpkvteywtqg
paaekaserlgstergqqlmaqhmtifptcsflpgintirawhprgpneievwaftvvda
dapeemkeeyrqqtlrtfsaggvfeqddgenwveiqqvlrghkarsrpfnaemglgqtds
dnpdypgtisyvyseeaarglytqwvrmmtspdwaaldatr

Sequence, based on observed residues (ATOM records):

>d1ulje2 d.129.3.3 (E:171-451) Biphenyl dioxygenase large subunit BphA1, C-terminal domain {Rhodococcus sp. (strain RHA1) [TaxId: 101510]}
apdldtylgeakfymdhmldrteagteaipgiqkwvipcnwkfaaeqfcsdmyhagttsh
lsgilaglptegiqyratwgghgsgfyigdpnlllaimgpkvteywtqgpaaekaserlg
stergqqlmaqhmtifptcsflpgintirawhprgpneievwaftvvdadapeemkeeyr
qqtlrtfsaggvfeqddgenwveiqqvlrghkarsrpfnaemglgqtdsdnpdypgtisy
vyseeaarglytqwvrmmtspdwaaldatr

Timeline for d1ulje2:

• d1ulje2 first appeared in SCOP 1.69
  
• d1ulje2 appears in SCOP 1.73
  
• d1ulje2 appears in SCOPe 2.01
  
• d1ulje2 appears in the current release, SCOPe 2.08