Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.4: NTF2-like [54427] (30 families) has a beta-alpha(2)-beta insertion after the main helix |
Family d.17.4.4: Ring hydroxylating beta subunit [54438] (6 proteins) Pfam PF00866 |
Protein Biphenyl dioxygenase small subunit BphA2 [110824] (1 species) |
Species Rhodococcus sp. (strain RHA1) [TaxId:101510] [110825] (2 PDB entries) Uniprot Q53123 11-187 |
Domain d1uljd_: 1ulj D: [107935] Other proteins in same PDB: d1ulja1, d1ulja2, d1uljc1, d1uljc2, d1ulje1, d1ulje2 |
PDB Entry: 1ulj (more details), 2.6 Å
SCOP Domain Sequences for d1uljd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uljd_ d.17.4.4 (D:) Biphenyl dioxygenase small subunit BphA2 {Rhodococcus sp. (strain RHA1) [TaxId: 101510]} afrtkpapvdpslqheieqfyyweakllndrrfqewfdllaedihyfmpirttrimreta qeysgareyahfddnaqmmrgrlrkitsdvswsenpasrtrhvisnvmivdgekpgeyhv ssvfivyrnrlerqldifagerkdilrrtgseagfelakrtilidqstilsnnlsfff
Timeline for d1uljd_: