Class b: All beta proteins [48724] (178 folds) |
Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
Superfamily b.33.1: ISP domain [50022] (4 families) |
Family b.33.1.2: Ring hydroxylating alpha subunit ISP domain [50033] (6 proteins) |
Protein Biphenyl dioxygenase large subunit BphA1, N-terminal domain [110156] (1 species) |
Species Rhodococcus sp. RHA1 [TaxId:101510] [110157] (2 PDB entries) Uniprot Q53122 17-451 |
Domain d1ulja1: 1ulj A:17-170 [107930] Other proteins in same PDB: d1ulja2, d1uljb_, d1uljc2, d1uljd_, d1ulje2, d1uljf_ complexed with bnl, fe2, fes |
PDB Entry: 1ulj (more details), 2.6 Å
SCOPe Domain Sequences for d1ulja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ulja1 b.33.1.2 (A:17-170) Biphenyl dioxygenase large subunit BphA1, N-terminal domain {Rhodococcus sp. RHA1 [TaxId: 101510]} wadadiaelvdertgrldpriytdealyeqelerifgrswllmghetqipkagdfmtnym gedpvmvvrqkngeirvflnqcrhrgmricradggnaksftcsyhgwaydtggnlvsvpf eeqafpglrkedwgplqarvetykglifanwdad
Timeline for d1ulja1: