| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species) |
| Species Human (Homo sapiens) [TaxId:9606] [88575] (173 PDB entries) including humanized antibodies (chimeric proteins with human constant domains) Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody |
| Domain d1uj3b2: 1uj3 B:418-517 [107891] Other proteins in same PDB: d1uj3a1, d1uj3a2, d1uj3b1, d1uj3c1, d1uj3c2 MQ NA P01857 # artificial chimera |
PDB Entry: 1uj3 (more details), 2.1 Å
SCOPe Domain Sequences for d1uj3b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1uj3b2 b.1.1.2 (B:418-517) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapcsrstsestaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtktytcnvdhkpsntkvdkrves
Timeline for d1uj3b2:
View in 3DDomains from other chains: (mouse over for more information) d1uj3a1, d1uj3a2, d1uj3c1, d1uj3c2 |