SCOPe 2.07: Domain d1uerc1: 1uer C:401-484

Lineage for d1uerc1 (1uer C:401-484)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins)

6. Protein Cambialistic superoxide dismutase [46622] (2 species)
   active with either Fe or Mn

7. Species Porphyromonas gingivalis [TaxId:837] [46624] (3 PDB entries)
   Uniprot P19665

8. Domain d1uerc1: 1uer C:401-484 [107794]
   Other proteins in same PDB: d1uera2, d1uerb2, d1uerc2, d1uerd2
   complexed with fe

Details for d1uerc1

PDB Entry: 1uer, 1.6 Å

PDB Description: Crystal structure of Porphyromonas gingivalis SOD

PDB Compounds: (C:) superoxide dismutase

SCOPe Domain Sequences for d1uerc1:

Sequence; same for both SEQRES and ATOM records:

>d1uerc1 a.2.11.1 (C:401-484) Cambialistic superoxide dismutase {Porphyromonas gingivalis [TaxId: 837]}
mthelislpyavdalapvisketvefhhgkhlktyvdnlnkliigtefenadlntivqks
eggifnnagqtlnhnlyftqfrpg

Timeline for d1uerc1:

• d1uerc1 first appeared in SCOP 1.69
  
• d1uerc1 appears in SCOPe 2.06
  
• d1uerc1 appears in the current release, SCOPe 2.08