Class a: All alpha proteins [46456] (284 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.1: Cytochrome P450 [48265] (23 proteins) |
Protein Cyp119 [48278] (2 species) thermophilic P450 |
Species Sulfolobus tokodaii [TaxId:111955] [109957] (2 PDB entries) Uniprot Q972I2 |
Domain d1ue8a_: 1ue8 A: [107781] Structural genomics target complexed with cl, hem |
PDB Entry: 1ue8 (more details), 3 Å
SCOPe Domain Sequences for d1ue8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Sulfolobus tokodaii [TaxId: 111955]} mydwfkqmrkespvyydgkvwnlfkyedckmvlndhkrfssnltgyndklemlrsgkvff diptrytmltsdpplhdelrnltadafnpsnlpvdfvrevtvkllseldeefdviesfai plpilviskmlginpdvkkvkdwsdlvalrlgradeifsigrkylelisfskkeldsrkg keivdltgkiansnlselekegyfillmiagnetttnlignaiedftlynswdyvrekga lkaveealrfsppvmrtirvtkekvkirdqvidegelvrvwiasanrdeevfkdpdsfip drtpnphlsfgsgihlclgaplarlearialeefakkfrvkeivkkekidnevlngyrkl vvrvert
Timeline for d1ue8a_: