| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.79: NusB-like [48012] (1 superfamily) 6 helices: bundle; one central helix is surrounded by 5 others |
Superfamily a.79.1: NusB-like [48013] (4 families) ![]() |
| Family a.79.1.1: Antitermination factor NusB [48014] (2 proteins) automatically mapped to Pfam PF01029 |
| Protein Antitermination factor NusB [48015] (3 species) |
| Species Thermotoga maritima [TaxId:2336] [109929] (5 PDB entries) Uniprot Q9X286 |
| Domain d1tztb_: 1tzt B: [107524] complexed with so4 |
PDB Entry: 1tzt (more details), 1.55 Å
SCOPe Domain Sequences for d1tztb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tztb_ a.79.1.1 (B:) Antitermination factor NusB {Thermotoga maritima [TaxId: 2336]}
ktprrrmrlavfkalfqhefrrdedleqileeildetydkkakedarryirgikenlsmi
ddlisrylekwslnrlsvvdrnvlrlatyellfekdipievtideaieiakrygtensgk
fvngildriakehapkekfel
Timeline for d1tztb_: