SCOP 1.69: Domain d1tvka2: 1tvk A:246-439

Lineage for d1tvka2 (1tvk A:246-439)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (1 family)

5. Family d.79.2.1: Tubulin, C-terminal domain [55308] (3 proteins)

6. Protein Tubulin alpha-subunit [55311] (2 species)

7. Species Cow (Bos taurus) [TaxId:9913] [64321] (4 PDB entries)

8. Domain d1tvka2: 1tvk A:246-439 [107363]
   Other proteins in same PDB: d1tvka1, d1tvkb1, d1tvkb2

Details for d1tvka2

PDB Entry: 1tvk, 2.89 Å

PDB Description: the binding mode of epothilone a on a,b-tubulin by electron crystallography

SCOP Domain Sequences for d1tvka2:

Sequence; same for both SEQRES and ATOM records:

>d1tvka2 d.79.2.1 (A:246-439) Tubulin alpha-subunit {Cow (Bos taurus)}
galnvdltefqtnlvpyprghfplatyapvisaekayheqlsvaeitnacfepanqmvkc
dprhgkymaccllyrgdvvpkdvnaaiatiktkrtiqfvdwcptgfkvginyepptvvpg
gdlakvqravcmlsnttaiaeawarldhkfdlmyakrafvhwyvgegmeegefsearedm
aalekdyeevgvds

Timeline for d1tvka2:

• d1tvka2 is new in SCOP 1.69
  
• d1tvka2 appears in SCOP 1.71
  
• d1tvka2 appears in the current release, SCOPe 2.08