SCOPe 2.08: Domain d1tufa1: 1tuf A:15-49,A:314-448

Lineage for d1tufa1 (1tuf A:15-49,A:314-448)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
   barrel, closed; n=6, S=8; greek-key
   Many cradle-loop superfamilies may be homologous, according to PubMed 18457946

4. Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families)
   the barrel is decorated with additional structures

5. Family b.49.2.3: Eukaryotic ODC-like [88683] (2 proteins)
   barrel is open with strands 4 and 5 having swapped their positions, compared to the alanine racemase barrel

6. Protein Diaminopimelate decarboxylase LysA [89350] (3 species)

7. Species Methanococcus jannaschii [TaxId:2190] [110245] (2 PDB entries)
   Uniprot Q58497

8. Domain d1tufa1: 1tuf A:15-49,A:314-448 [107335]
   Other proteins in same PDB: d1tufa2, d1tufb2
   Structural genomics target
   complexed with az1

Details for d1tufa1

PDB Entry: 1tuf, 2.4 Å

PDB Description: crystal structure of diaminopimelate decarboxylase from m. jannaschi

PDB Compounds: (A:) diaminopimelate decarboxylase

SCOPe Domain Sequences for d1tufa1:

Sequence; same for both SEQRES and ATOM records:

>d1tufa1 b.49.2.3 (A:15-49,A:314-448) Diaminopimelate decarboxylase LysA {Methanococcus jannaschii [TaxId: 2190]}
flgndtveikdgrffidgydaielaekfgtplyvmXgyllgkvhhiketpvtkwvmidag
mndmmrpamyeayhhiinckvknekevvsiagglcessdvfgrdreldkvevgdvlaifd
vgaygismannynargrprmvltskkgvflireretyadliakdivpphll

Timeline for d1tufa1:

• d1tufa1 first appeared in SCOP 1.69
  
• d1tufa1 appears in SCOPe 2.07