Lineage for d1ttua1 (1ttu A:542-660)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 788950Superfamily b.1.18: E set domains [81296] (23 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 788951Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (7 proteins)
    subgroup of the larger IPT/TIG domain family
  6. 788959Protein DNA-binding protein LAG-1 (CSL) [110052] (1 species)
  7. 788960Species Caenorhabditis elegans [TaxId:6239] [110053] (4 PDB entries)
    Uniprot Q9TYY1 195-660
  8. 788963Domain d1ttua1: 1ttu A:542-660 [107305]
    Other proteins in same PDB: d1ttua2, d1ttua3
    complexed with egl

Details for d1ttua1

PDB Entry: 1ttu (more details), 2.85 Å

PDB Description: Crystal Structure of CSL bound to DNA
PDB Compounds: (A:) lin-12 And Glp-1 transcriptional regulator

SCOP Domain Sequences for d1ttua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ttua1 b.1.18.1 (A:542-660) DNA-binding protein LAG-1 (CSL) {Caenorhabditis elegans [TaxId: 6239]}
dkaeyrffeamgqvanpispcpvvgslevdghgeasrvelhgrdfkpnlkvwfgatpvet
tfrseeslhcsippvsqvrneqthwmftnrttgdvevpislvrddgvvyssgltfsyks

SCOP Domain Coordinates for d1ttua1:

Click to download the PDB-style file with coordinates for d1ttua1.
(The format of our PDB-style files is described here.)

Timeline for d1ttua1: