Lineage for d1tqyc2 (1tqy C:219-423)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 495246Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 495247Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 495248Family c.95.1.1: Thiolase-related [53902] (7 proteins)
  6. 495249Protein Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA [110752] (1 species)
  7. 495250Species Streptomyces coelicolor [TaxId:1902] [110753] (1 PDB entry)
  8. 495254Domain d1tqyc2: 1tqy C:219-423 [107250]
    Other proteins in same PDB: d1tqyb1, d1tqyb2, d1tqyd1, d1tqyd2, d1tqyf1, d1tqyf2, d1tqyh1, d1tqyh2

Details for d1tqyc2

PDB Entry: 1tqy (more details), 2 Å

PDB Description: the actinorhodin ketosynthase/chain length factor

SCOP Domain Sequences for d1tqyc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tqyc2 c.95.1.1 (C:219-423) Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA {Streptomyces coelicolor}
ddpehasrpfdgtrdgfvlaegaamfvledydsalargarihaeisgyatrcnayhmtgl
kadgremaetirvaldesrtdatdidyinahgsgtrqndrhetaaykralgeharrtpvs
siksmvghslgaigsleiaacvlalehgvvpptanlrtsdpecdldyvplearerklrsv
ltvgsgfggfqsamvlrdaetagaa

SCOP Domain Coordinates for d1tqyc2:

Click to download the PDB-style file with coordinates for d1tqyc2.
(The format of our PDB-style files is described here.)

Timeline for d1tqyc2: