Lineage for d1tpxa_ (1tpx A:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 852251Fold d.6: Prion-like [54097] (1 superfamily)
    beta-alpha-beta-alpha(2); antiparallel beta-ribbon
  4. 852252Superfamily d.6.1: Prion-like [54098] (1 family) (S)
  5. 852253Family d.6.1.1: Prion-like [54099] (2 proteins)
  6. 852254Protein Prion protein domain [54100] (12 species)
  7. 852299Species Sheep (Ovis aries) [TaxId:9940] [102729] (6 PDB entries)
    Uniprot P23907 124-234
    Uniprot P23907 122-234
    Uniprot P23907 127-228
    Uniprot P23907 124-234 ! Uniprot P23907 122-234 ! Uniprot P23907 127-228
  8. 852304Domain d1tpxa_: 1tpx A: [107189]
    Other proteins in same PDB: d1tpxb1, d1tpxb2, d1tpxc1, d1tpxc2

Details for d1tpxa_

PDB Entry: 1tpx (more details), 2.56 Å

PDB Description: Ovine recombinant PrP(114-234), ARQ variant in complex with the Fab of the VRQ14 antibody
PDB Compounds: (A:) major prion protein

SCOP Domain Sequences for d1tpxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tpxa_ d.6.1.1 (A:) Prion protein domain {Sheep (Ovis aries) [TaxId: 9940]}
glggymlgsamsrplihfgndyedryyrenmyrypnqvyyrpvdqysnqnnfvhdcvnit
vkqhtvttttkgenftetdikimervveqmcitqyqresqay

SCOP Domain Coordinates for d1tpxa_:

Click to download the PDB-style file with coordinates for d1tpxa_.
(The format of our PDB-style files is described here.)

Timeline for d1tpxa_: