Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.6: Prion-like [54097] (1 superfamily) beta-alpha-beta-alpha(2); antiparallel beta-ribbon |
Superfamily d.6.1: Prion-like [54098] (1 family) |
Family d.6.1.1: Prion-like [54099] (2 proteins) |
Protein Prion protein domain [54100] (12 species) |
Species Sheep (Ovis aries) [TaxId:9940] [102729] (6 PDB entries) Uniprot P23907 124-234 Uniprot P23907 122-234 Uniprot P23907 127-228 Uniprot P23907 124-234 ! Uniprot P23907 122-234 ! Uniprot P23907 127-228 |
Domain d1tpxa_: 1tpx A: [107189] Other proteins in same PDB: d1tpxb1, d1tpxb2, d1tpxc1, d1tpxc2 |
PDB Entry: 1tpx (more details), 2.56 Å
SCOP Domain Sequences for d1tpxa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tpxa_ d.6.1.1 (A:) Prion protein domain {Sheep (Ovis aries) [TaxId: 9940]} glggymlgsamsrplihfgndyedryyrenmyrypnqvyyrpvdqysnqnnfvhdcvnit vkqhtvttttkgenftetdikimervveqmcitqyqresqay
Timeline for d1tpxa_:
View in 3D Domains from other chains: (mouse over for more information) d1tpxb1, d1tpxb2, d1tpxc1, d1tpxc2 |