Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.2: D-glucarate dehydratase-like [51609] (14 proteins) |
Protein L-Ala-D/L-Glu epimerase [69397] (2 species) |
Species Bacillus subtilis [TaxId:1423] [69399] (2 PDB entries) Uniprot O34508 |
Domain d1tkkg1: 1tkk G:126-358 [107101] Other proteins in same PDB: d1tkka2, d1tkkb2, d1tkkc2, d1tkkd2, d1tkke2, d1tkkf2, d1tkkg2, d1tkkh2 complexed with ala, mg |
PDB Entry: 1tkk (more details), 2.1 Å
SCOPe Domain Sequences for d1tkkg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tkkg1 c.1.11.2 (G:126-358) L-Ala-D/L-Glu epimerase {Bacillus subtilis [TaxId: 1423]} yrdtletdytvsvnspeemaadaenylkqgfqtlkikvgkddiatdiariqeirkrvgsa vklrldanqgwrpkeavtairkmedaglgielveqpvhkddlaglkkvtdatdtpimade svftprqafevlqtrsadliniklmkaggisgaekinamaeacgvecmvgsmietklgit aaahfaaskrnitrfdfdaplmlktdvfnggitysgstismpgkpglgiigaa
Timeline for d1tkkg1: