Lineage for d1tkke2 (1tkk E:2-125)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 602849Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 602850Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family) (S)
  5. 602851Family d.54.1.1: Enolase N-terminal domain-like [54827] (12 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 602944Protein L-Ala-D/L-Glu epimerase [69711] (2 species)
  7. 602945Species Bacillus subtilis [TaxId:1423] [69713] (2 PDB entries)
  8. 602954Domain d1tkke2: 1tkk E:2-125 [107098]
    Other proteins in same PDB: d1tkka1, d1tkkb1, d1tkkc1, d1tkkd1, d1tkke1, d1tkkf1, d1tkkg1, d1tkkh1

Details for d1tkke2

PDB Entry: 1tkk (more details), 2.1 Å

PDB Description: The Structure of a Substrate-Liganded Complex of the L-Ala-D/L-Glu Epimerase from Bacillus subtilis

SCOP Domain Sequences for d1tkke2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tkke2 d.54.1.1 (E:2-125) L-Ala-D/L-Glu epimerase {Bacillus subtilis}
kiirietsriavpltkpfktalrtvytaesvivritydsgavgwgeapptlvitgdsmds
iesaihhvlkpallgkslagyeailhdiqhlltgnmsakaavemalydgwaqmcglplyq
mlgg

SCOP Domain Coordinates for d1tkke2:

Click to download the PDB-style file with coordinates for d1tkke2.
(The format of our PDB-style files is described here.)

Timeline for d1tkke2: