SCOP 1.73: Domain d1tgec1: 1tge C:298-395

Lineage for d1tgec1 (1tge C:298-395)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (20 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (2 proteins)

6. Protein Envelope glycoprotein [49213] (5 species)

7. Species Dengue virus type 2 [TaxId:11060] [89194] (7 PDB entries)

8. Domain d1tgec1: 1tge C:298-395 [106898]
   Other proteins in same PDB: d1tgea2, d1tgeb2, d1tgec2

Details for d1tgec1

PDB Entry: 1tge

PDB Description: the structure of immature dengue virus at 12.5 angstrom

PDB Compounds: (C:) Envelope glycoprotein

SCOP Domain Sequences for d1tgec1:

Sequence; same for both SEQRES and ATOM records:

>d1tgec1 b.1.18.4 (C:298-395) Envelope glycoprotein {Dengue virus type 2 [TaxId: 11060]}
sysmctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpi
vtekdspvnieaeppfgdsyiiigvepgqlklnwfkkg

Timeline for d1tgec1:

• d1tgec1 first appeared in SCOP 1.69
  
• d1tgec1 appears in SCOP 1.71
  
• d1tgec1 appears in SCOP 1.75
  
• d1tgec1 appears in the current release, SCOPe 2.08