Class b: All beta proteins [48724] (149 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (18 families) "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (2 proteins) |
Protein Envelope glycoprotein [49213] (4 species) |
Species Dengue virus type 2 [TaxId:12637] [89194] (6 PDB entries) |
Domain d1tgec1: 1tge C:298-395 [106898] Other proteins in same PDB: d1tgea2, d1tgeb2, d1tgec2 |
PDB Entry: 1tge (more details)
SCOP Domain Sequences for d1tgec1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tgec1 b.1.18.4 (C:298-395) Envelope glycoprotein {Dengue virus type 2} sysmctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpi vtekdspvnieaeppfgdsyiiigvepgqlklnwfkkg
Timeline for d1tgec1:
View in 3D Domains from other chains: (mouse over for more information) d1tgea1, d1tgea2, d1tgeb1, d1tgeb2 |