Class b: All beta proteins [48724] (174 folds) |
Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily) pseudobarrel; capped on both ends by alpha-helices |
Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (1 family) automatically mapped to Pfam PF01149 |
Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (3 proteins) |
Protein Endonuclease VIII-like 1 (NEIL1) [110335] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [110336] (1 PDB entry) Uniprot Q96FI4 1-333 |
Domain d1tdha2: 1tdh A:2-131 [106773] Other proteins in same PDB: d1tdha1, d1tdha3 complexed with trs |
PDB Entry: 1tdh (more details), 2.1 Å
SCOPe Domain Sequences for d1tdha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tdha2 b.113.1.1 (A:2-131) Endonuclease VIII-like 1 (NEIL1) {Human (Homo sapiens) [TaxId: 9606]} pegpelhlasqfvneacralvfggcvekssvsrnpevpfessayrisasargkelrlils plpgaqpqqeplalvfrfgmsgsfqlvpreelprhahlrfytappgprlalcfvdirrfg rwdlggkwqp
Timeline for d1tdha2: