Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species) |
Species Human (Homo sapiens) [TaxId:9606] [88585] (28 PDB entries) Uniprot P01857 #118-327 Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region Uniprot P01857 #118-327 ! Uniprot P01857 118-327 # GC1_HUMAN Ig gamma-1 chain C region |
Domain d1t89b1: 1t89 B:235-341 [106659] Other proteins in same PDB: d1t89a2, d1t89b2, d1t89c1, d1t89c2 complexed with fuc, gal, man, nag |
PDB Entry: 1t89 (more details), 3.5 Å
SCOP Domain Sequences for d1t89b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t89b1 b.1.1.2 (B:235-341) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Human (Homo sapiens) [TaxId: 9606]} lggpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpree qynstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiskakg
Timeline for d1t89b1:
View in 3D Domains from other chains: (mouse over for more information) d1t89a1, d1t89a2, d1t89c1, d1t89c2 |