Lineage for d1t56a1 (1t56 A:22-94)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305223Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 2305653Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
  6. 2305660Protein Ethr repressor [109651] (2 species)
  7. 2305661Species Mycobacterium tuberculosis [TaxId:1773] [109652] (34 PDB entries)
    Uniprot P96222 22-215
  8. 2305662Domain d1t56a1: 1t56 A:22-94 [106428]
    Other proteins in same PDB: d1t56a2
    complexed with dio, gol

Details for d1t56a1

PDB Entry: 1t56 (more details), 1.7 Å

PDB Description: Crystal structure of TetR family repressor M. tuberculosis EthR
PDB Compounds: (A:) EthR repressor

SCOPe Domain Sequences for d1t56a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t56a1 a.4.1.9 (A:22-94) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}
gddrelailataenlledrpladisvddlakgagisrptfyfyfpskeavlltlldrvvn
qadmalqtlaenp

SCOPe Domain Coordinates for d1t56a1:

Click to download the PDB-style file with coordinates for d1t56a1.
(The format of our PDB-style files is described here.)

Timeline for d1t56a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1t56a2