SCOP 1.71: Domain d1t3ta6: 1t3t A:430-616

Lineage for d1t3ta6 (1t3t A:430-616)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.139: PurM C-terminal domain-like [56041] (1 superfamily)
   3 layers: alpha/beta/alpha; partial topological similarity to the ferredoxin-like fold

4. Superfamily d.139.1: PurM C-terminal domain-like [56042] (1 family)

5. Family d.139.1.1: PurM C-terminal domain-like [56043] (4 proteins)

6. Protein FGAM synthase PurL, PurM-like module, C1 and C2 domains [111181] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [111182] (1 PDB entry)

8. Domain d1t3ta6: 1t3t A:430-616 [106386]
   Other proteins in same PDB: d1t3ta1, d1t3ta2, d1t3ta3, d1t3ta4, d1t3ta5

Details for d1t3ta6

PDB Entry: 1t3t, 1.9 Å

PDB Description: Structure of Formylglycinamide synthetase

SCOP Domain Sequences for d1t3ta6:

Sequence, based on SEQRES records:

>d1t3ta6 d.139.1.1 (A:430-616) FGAM synthase PurL, PurM-like module, C1 and C2 domains {Salmonella typhimurium}
ivvgaklivlggpamniglgggaassmasgqsdadldfasvqrdnpemerrcqevidrcw
qlgdanpilfihdvgagglsnampelvsdggrggkfelrdilsdepgmspleiwcnesqe
ryvlavaadqlplfdelckrerapyavigdateeqhlslhdnhfdnqpidlpldvllgkt
pkmtrdv

Sequence, based on observed residues (ATOM records):

>d1t3ta6 d.139.1.1 (A:430-616) FGAM synthase PurL, PurM-like module, C1 and C2 domains {Salmonella typhimurium}
ivvgaklivlggpamnigfasvqrdnpemerrcqevidrcwqlgdanpilfihdvgaggl
snampelvsdggrggkfelrdilsdepgmspleiwcnesqeryvlavaadqlplfdelck
rerapyavigdateeqhlslhdnhfdnqpidlpldvllgktpkmtrdv

Timeline for d1t3ta6:

• d1t3ta6 first appeared in SCOP 1.69
  
• d1t3ta6 appears in SCOP 1.73
  
• d1t3ta6 appears in the current release, SCOPe 2.08