Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (7 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.4: PurM N-terminal domain-like [55326] (1 family) |
Family d.79.4.1: PurM N-terminal domain-like [55327] (4 proteins) |
Protein FGAM synthase PurL, PurM-like module, N1 and N2 domains [111035] (1 species) |
Species Salmonella typhimurium [TaxId:90371] [111036] (1 PDB entry) |
Domain d1t3ta4: 1t3t A:221-429 [106384] Other proteins in same PDB: d1t3ta1, d1t3ta2, d1t3ta3, d1t3ta6, d1t3ta7 |
PDB Entry: 1t3t (more details), 1.9 Å
SCOP Domain Sequences for d1t3ta4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1t3ta4 d.79.4.1 (A:221-429) FGAM synthase PurL, PurM-like module, N1 and N2 domains {Salmonella typhimurium} ifnadwiidgkpqpkslfkmikntfettpdyvlsaykdnaavmegsavgryfadhntgry dfhqepahilmkvethnhptaispwpgaatgsggeirdegatgrgakpkaglvgfsvsnl ripgfeqpweedfgkperivtaldimtegplggaafnnefgrpaltgyfrtyeekvnshn geelrgyhkpimlaggigniradhvqkge
Timeline for d1t3ta4: