Lineage for d1t1rb2 (1t1r B:1-125)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 574151Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 574152Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 575085Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (18 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 575086Protein 1-deoxy-D-xylulose-5-phosphate reductoisomerase [69410] (2 species)
  7. 575087Species Escherichia coli [TaxId:562] [69411] (10 PDB entries)
  8. 575093Domain d1t1rb2: 1t1r B:1-125 [106267]
    Other proteins in same PDB: d1t1ra1, d1t1ra4, d1t1rb1, d1t1rb4

Details for d1t1rb2

PDB Entry: 1t1r (more details), 2.3 Å

PDB Description: Crystal Structure of the Reductoisomerase Complexed with a Bisphosphonate

SCOP Domain Sequences for d1t1rb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t1rb2 c.2.1.3 (B:1-125) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli}
kqltilgstgsigcstldvvrhnpehfrvvalvagknvtrmveqclefspryavmddeas
akllktmlqqqgsrtevlsgqqaacdmaaledvdqvmaaivgaagllptlaairagktil
lanke

SCOP Domain Coordinates for d1t1rb2:

Click to download the PDB-style file with coordinates for d1t1rb2.
(The format of our PDB-style files is described here.)

Timeline for d1t1rb2: