Lineage for d1t0bc_ (1t0b C:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1356042Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1358417Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 1358767Family c.23.16.6: ThuA-like [110486] (1 protein)
    Pfam PF06283; overall fold is very similar the class I GAT family but the putative active site has a different structure
  6. 1358768Protein GK2113 homologue [110487] (1 species)
  7. 1358769Species Bacillus stearothermophilus [TaxId:1422] [110488] (1 PDB entry)
    Uniprot Q5KY38 # 99% sequence identity (Geobacillus kaustophilus TaxID:1462)
  8. 1358772Domain d1t0bc_: 1t0b C: [106201]
    Structural genomics target
    complexed with zn

Details for d1t0bc_

PDB Entry: 1t0b (more details), 1.7 Å

PDB Description: structure of thua-like protein from bacillus stearothermophilus
PDB Compounds: (C:) ThuA-like protein

SCOPe Domain Sequences for d1t0bc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1t0bc_ c.23.16.6 (C:) GK2113 homologue {Bacillus stearothermophilus [TaxId: 1422]}
tpirvvvwnefrhekkdeqvraiypegmhtviasylaeagfdaatavldepehgltdevl
drcdvlvwwghiahdevkdevvervhrrvlegmglivlhsghfskifkklmgttcnlkwr
eadekerlwvvapghpivegigpyieleqeemygeffdipepdetifiswfeggevfrsg
ctftrgkgkifyfrpghetyptyhhpdvlkvianavrwaapvnrgeivfgnvkplepika

SCOPe Domain Coordinates for d1t0bc_:

Click to download the PDB-style file with coordinates for d1t0bc_.
(The format of our PDB-style files is described here.)

Timeline for d1t0bc_: