Lineage for d1srub_ (1sru B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2398969Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (13 proteins)
    barrel, closed; n=5, S=10
  6. 2399062Protein ssDNA-binding protein [50264] (4 species)
  7. 2399065Species Escherichia coli [TaxId:562] [50266] (6 PDB entries)
    Uniprot P02339
  8. 2399087Domain d1srub_: 1sru B: [105972]

Details for d1srub_

PDB Entry: 1sru (more details), 3.3 Å

PDB Description: Crystal structure of full length E. coli SSB protein
PDB Compounds: (B:) Single-strand binding protein

SCOPe Domain Sequences for d1srub_:

Sequence, based on SEQRES records: (download)

>d1srub_ b.40.4.3 (B:) ssDNA-binding protein {Escherichia coli [TaxId: 562]}
asrgvnkvilvgnlgqdpevrympnggavanitlatseswrdkatgemkeqtewhrvvlf
gklaevaseylrkgsqvyiegqlrtrkwtdqsgqdryttevvvnvggtmqml

Sequence, based on observed residues (ATOM records): (download)

>d1srub_ b.40.4.3 (B:) ssDNA-binding protein {Escherichia coli [TaxId: 562]}
asrgvnkvilvgnlgqdpevravanitlatsesweqtewhrvvlfgklaevaseylrkgs
qvyiegqlrtrkwtdqsgqdryttevvvnvggtmqml

SCOPe Domain Coordinates for d1srub_:

Click to download the PDB-style file with coordinates for d1srub_.
(The format of our PDB-style files is described here.)

Timeline for d1srub_: