![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) ![]() automatically mapped to Pfam PF05365 |
![]() | Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (2 proteins) |
![]() | Protein Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81512] (3 species) interacts with cytochrome c1 and ISP |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81509] (20 PDB entries) Uniprot P00130 |
![]() | Domain d1sqbj_: 1sqb J: [105904] Other proteins in same PDB: d1sqba1, d1sqba2, d1sqbb1, d1sqbb2, d1sqbc1, d1sqbc2, d1sqbd1, d1sqbd2, d1sqbe1, d1sqbe2, d1sqbf_, d1sqbg_, d1sqbh_, d1sqbi_, d1sqbk_ complexed with azo, fes, hem |
PDB Entry: 1sqb (more details), 2.69 Å
SCOPe Domain Sequences for d1sqbj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sqbj_ f.23.14.1 (J:) Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]} vaptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhkye n
Timeline for d1sqbj_: