SCOP 1.73: Domain d1sqbf_: 1sqb F:

Lineage for d1sqbf_ (1sqb F:)

1. Root: SCOP 1.73

2. Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)

3. Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily)
   membrane-associated alpha-helical protein; no transmembrane helices

4. Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family)
   location - matrix side of the bc1 complex

5. Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (1 protein)
   probably important for the complex assembly, caps the matrix face of cytochrome b

6. Protein 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81522] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81519] (17 PDB entries)

8. Domain d1sqbf_: 1sqb F: [105900]
   Other proteins in same PDB: d1sqba1, d1sqba2, d1sqbb1, d1sqbb2, d1sqbc1, d1sqbc2, d1sqbd1, d1sqbd2, d1sqbe1, d1sqbe2, d1sqbg_, d1sqbh_, d1sqbi_, d1sqbj_, d1sqbk_
   complexed with azo, fes, hem

Details for d1sqbf_

PDB Entry: 1sqb, 2.69 Å

PDB Description: Crystal Structure Analysis of Bovine Bc1 with Azoxystrobin

PDB Compounds: (F:) Ubiquinol-cytochrome c reductase complex 14 kDa protein

SCOP Domain Sequences for d1sqbf_:

Sequence; same for both SEQRES and ATOM records:

>d1sqbf_ f.27.1.1 (F:) 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus) [TaxId: 9913]}
vsassrwlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvfrikra
ldlsmrqqilpkeqwtkyeedksylepylkevirerkereewakk

Timeline for d1sqbf_:

• d1sqbf_ first appeared in SCOP 1.69
  
• d1sqbf_ appears in SCOP 1.71
  
• d1sqbf_ appears in SCOP 1.75
  
• d1sqbf_ appears in the current release, SCOPe 2.08