SCOPe 2.03: Domain d1smoa_: 1smo A:

Lineage for d1smoa_ (1smo A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein TREM-1 (triggering receptor expressed on myeloid cells 1) [101506] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101507] (2 PDB entries)
   Uniprot Q9NP99 21-133

8. Domain d1smoa_: 1smo A: [105764]
   complexed with tla

Details for d1smoa_

PDB Entry: 1smo, 1.47 Å

PDB Description: Crystal Structure of Human Triggering Receptor Expressed on Myeloid Cells 1 (TREM-1) at 1.47 .

PDB Compounds: (A:) triggering receptor expressed on myeloid cells 1

SCOPe Domain Sequences for d1smoa_:

Sequence; same for both SEQRES and ATOM records:

>d1smoa_ b.1.1.1 (A:) TREM-1 (triggering receptor expressed on myeloid cells 1) {Human (Homo sapiens) [TaxId: 9606]}
atklteekyelkegqtldvkcdytlekfassqkawqiirdgempktlacterpsknshpv
qvgriiledyhdhgllrvrmvnlqvedsglyqcviyqppkephmlfdrirlvv

Timeline for d1smoa_:

• d1smoa_ first appeared in SCOP 1.69
  
• d1smoa_ appears in SCOPe 2.02
  
• d1smoa_ appears in SCOPe 2.04
  
• d1smoa_ appears in the current release, SCOPe 2.08