![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) ![]() |
![]() | Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
![]() | Protein Polypyrimidine tract-binding protein [54950] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [54951] (7 PDB entries) Uniprot P26599 54-141, 177-284, 335-531 |
![]() | Domain d1sjra_: 1sjr A: [105661] RR2 |
PDB Entry: 1sjr (more details)
SCOPe Domain Sequences for d1sjra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sjra_ d.58.7.1 (A:) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} magqspvlriivenlfypvtldvlhqifskfgtvlkiitftknnqfqallqyadpvsaqh aklsldgqniynacctlridfskltslnvkynndksrdytrpdlpsgd
Timeline for d1sjra_: