SCOP 1.69: Domain d1s7ia_: 1s7i A:

Lineage for d1s7ia_ (1s7i A:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.58: Ferredoxin-like [54861] (49 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (11 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.9: DGPF domain (Pfam 04946) [110962] (1 protein)
   there is the putative active site cavity in the equivalent location location to the MLI and YciI active sites

6. Protein Hypothetical protein PA1349 [110963] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [110964] (1 PDB entry)

8. Domain d1s7ia_: 1s7i A: [105353]
   Structural genomics target

Details for d1s7ia_

PDB Entry: 1s7i, 1.8 Å

PDB Description: 1.8 A Crystal Structure of a Protein of Unknown Function PA1349 from Pseudomonas aeruginosa

SCOP Domain Sequences for d1s7ia_:

Sequence; same for both SEQRES and ATOM records:

>d1s7ia_ d.58.4.9 (A:) Hypothetical protein PA1349 {Pseudomonas aeruginosa}
lyfqgnmkylcliyfdeaklaavpaeelaaivdecmtysdqlgkaghyiashalqsvqta
ttlrhqggrlamtdgpfaetkeqlggfylieardlnqalqiaakippgrlgcvevrpvke
wegs

Timeline for d1s7ia_:

• d1s7ia_ is new in SCOP 1.69
  
• d1s7ia_ appears in SCOP 1.71
  
• d1s7ia_ appears in the current release, SCOPe 2.08, called d1s7ia1