Lineage for d1s7ia1 (1s7i A:7-122)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949708Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) (S)
    dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers
  5. 2949874Family d.58.4.9: DGPF domain (Pfam 04946) [110962] (1 protein)
    there is the putative active site cavity in the equivalent location location to the MLI and YciI active sites
    automatically mapped to Pfam PF03795
  6. 2949875Protein Hypothetical protein PA1349 [110963] (1 species)
  7. 2949876Species Pseudomonas aeruginosa [TaxId:287] [110964] (1 PDB entry)
    Uniprot Q9I3Z5
  8. 2949877Domain d1s7ia1: 1s7i A:7-122 [105353]
    Other proteins in same PDB: d1s7ia2, d1s7ia3
    Structural genomics target

Details for d1s7ia1

PDB Entry: 1s7i (more details), 1.8 Å

PDB Description: 1.8 A Crystal Structure of a Protein of Unknown Function PA1349 from Pseudomonas aeruginosa
PDB Compounds: (A:) hypothetical protein PA1349

SCOPe Domain Sequences for d1s7ia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1s7ia1 d.58.4.9 (A:7-122) Hypothetical protein PA1349 {Pseudomonas aeruginosa [TaxId: 287]}
mkylcliyfdeaklaavpaeelaaivdecmtysdqlgkaghyiashalqsvqtattlrhq
ggrlamtdgpfaetkeqlggfylieardlnqalqiaakippgrlgcvevrpvkewe

SCOPe Domain Coordinates for d1s7ia1:

Click to download the PDB-style file with coordinates for d1s7ia1.
(The format of our PDB-style files is described here.)

Timeline for d1s7ia1: