Class a: All alpha proteins [46456] (284 folds) |
Fold a.102: alpha/alpha toroid [48207] (6 superfamilies) multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies |
Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (4 families) |
Family a.102.4.3: Protein prenyltransferases [48246] (2 proteins) |
Protein Protein farnesyltransferase, beta-subunit [48247] (2 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [48248] (29 PDB entries) Uniprot Q02293 22-418 P53610 |
Domain d1s64b_: 1s64 B: [105288] Other proteins in same PDB: d1s64a_, d1s64c_, d1s64e_, d1s64g_, d1s64i_, d1s64k_ |
PDB Entry: 1s64 (more details), 2.55 Å
SCOP Domain Sequences for d1s64b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1s64b_ a.102.4.3 (B:) Protein farnesyltransferase, beta-subunit {Rat (Rattus norvegicus) [TaxId: 10116]} ldflrdrhvrffqrclqvlperyssletsrltiaffalsgldmldsldvvnkddiiewiy slqvlptedrsnldrcgfrgssylgipfnpsknpgtahpydsghiamtytglscliilgd dlsrvdkeaclaglralqledgsfcavpegsendmrfvycascicymlnnwsgmdmkkai syirrsmsydnglaqgagleshggstfcgiaslclmgkleevfsekelnrikrwcimrqq ngyhgrpnkpvdtcysfwvgatlkllkifqytnfeknrnyilstqdrlvggfakwpdshp dalhayfgicglslmeesgickvhpalnvstrtserlrdlhqswkt
Timeline for d1s64b_: