Lineage for d1s3oa_ (1s3o A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 667292Fold b.40: OB-fold [50198] (12 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 668013Superfamily b.40.4: Nucleic acid-binding proteins [50249] (14 families) (S)
  5. 668080Family b.40.4.3: Single strand DNA-binding domain, SSB [50263] (12 proteins)
    barrel, closed; n=5, S=10
  6. 668169Protein ssDNA-binding protein [50264] (4 species)
  7. 668193Species Human (Homo sapiens), mitochondria [TaxId:9606] [50265] (3 PDB entries)
  8. 668196Domain d1s3oa_: 1s3o A: [105247]

Details for d1s3oa_

PDB Entry: 1s3o (more details), 2.47 Å

PDB Description: Human mitochondrial single strand DNA binding protein (hmSSB)
PDB Compounds: (A:) Single-stranded DNA-binding protein, mitochondrial

SCOP Domain Sequences for d1s3oa_:

Sequence, based on SEQRES records: (download)

>d1s3oa_ b.40.4.3 (A:) ssDNA-binding protein {Human (Homo sapiens), mitochondria [TaxId: 9606]}
lerslnrvhllgrvgqdpvlrqvegknpvtifslatnemwrsgdsevyqlgdvsqkttwh
risvfrpglrdvayqyvkkgsriylegkidygeymdknnvrrqattiiadniifls

Sequence, based on observed residues (ATOM records): (download)

>d1s3oa_ b.40.4.3 (A:) ssDNA-binding protein {Human (Homo sapiens), mitochondria [TaxId: 9606]}
lerslnrvhllgrvgqdpvlrqvegknpvtifslatnemwrsdvsqkttwhrisvfrpgl
rdvayqyvkkgsriylegkidygeymdknnvrrqattiiadniifls

SCOP Domain Coordinates for d1s3oa_:

Click to download the PDB-style file with coordinates for d1s3oa_.
(The format of our PDB-style files is described here.)

Timeline for d1s3oa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1s3ob_