Lineage for d1rj2a1 (1rj2 A:624-818)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2332669Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily)
    multihelical; core: 5-helical bundle
  4. 2332670Superfamily a.87.1: DBL homology domain (DH-domain) [48065] (2 families) (S)
    automatically mapped to Pfam PF00621
  5. 2332671Family a.87.1.1: DBL homology domain (DH-domain) [48066] (10 proteins)
    Pfam PF00621
  6. 2332675Protein Dbl's big sister, Dbs [74743] (1 species)
  7. 2332676Species Mouse (Mus musculus) [TaxId:10090] [74744] (4 PDB entries)
    Uniprot Q64096 624-958 # 98% sequence identity; the rat sequence Q63406 region 499-833 is 100% identical to the PDB sequence
  8. 2332685Domain d1rj2a1: 1rj2 A:624-818 [104954]
    Other proteins in same PDB: d1rj2a2, d1rj2d2, d1rj2g2, d1rj2j2

Details for d1rj2a1

PDB Entry: 1rj2 (more details), 3 Å

PDB Description: Crystal structure of the DH/PH fragment of Dbs without bound GTPase
PDB Compounds: (A:) Guanine nucleotide exchange factor DBS [Fragment]

SCOPe Domain Sequences for d1rj2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rj2a1 a.87.1.1 (A:624-818) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]}
eeeeslailrrhvmnelldterayveellcvlegyaaemdnplmahlistglqnkknilf
gnmeeiyhfhnriflrelescidcpelvgrcflermeefqiyekycqnkprseslwrqcs
dcpffqecqkkldhklsldsyllkpvqritkyqlllkemlkyskhcegaedlqealssil
gilkavndsmhliai

SCOPe Domain Coordinates for d1rj2a1:

Click to download the PDB-style file with coordinates for d1rj2a1.
(The format of our PDB-style files is described here.)

Timeline for d1rj2a1: