Lineage for d1rcqa1 (1rcq A:1-7,A:234-357)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2798607Fold b.49: Domain of alpha and beta subunits of F1 ATP synthase-like [50614] (4 superfamilies)
    barrel, closed; n=6, S=8; greek-key
    Many cradle-loop superfamilies may be homologous, according to PubMed 18457946
  4. 2798988Superfamily b.49.2: Alanine racemase C-terminal domain-like [50621] (2 families) (S)
    the barrel is decorated with additional structures
  5. 2798989Family b.49.2.2: Alanine racemase-like, C-terminal domain [88682] (2 proteins)
  6. 2798990Protein Alanine racemase [50623] (3 species)
  7. 2799008Species Pseudomonas aeruginosa [TaxId:287] [110243] (1 PDB entry)
    Uniprot Q9HTQ2
  8. 2799009Domain d1rcqa1: 1rcq A:1-7,A:234-357 [104882]
    Other proteins in same PDB: d1rcqa2
    complexed with dly, plp

Details for d1rcqa1

PDB Entry: 1rcq (more details), 1.45 Å

PDB Description: The 1.45 A crystal structure of alanine racemase from a pathogenic bacterium, Pseudomonas aeruginosa, contains both internal and external aldimine forms
PDB Compounds: (A:) catabolic alanine racemase DadX

SCOPe Domain Sequences for d1rcqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1rcqa1 b.49.2.2 (A:1-7,A:234-357) Alanine racemase {Pseudomonas aeruginosa [TaxId: 287]}
mrparalXtleskvisvrdlpagepvgygarysterrqrigvvamgyadgyprhaadgtl
vfidgkpgrlvgrvsmdmltvdltdhpqaglgsrvelwgpnvpvgalaaqfgsipyqllc
nlkrvprvysga

SCOPe Domain Coordinates for d1rcqa1:

Click to download the PDB-style file with coordinates for d1rcqa1.
(The format of our PDB-style files is described here.)

Timeline for d1rcqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1rcqa2