Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
Protein 1-deoxy-D-xylulose-5-phosphate reductoisomerase [69410] (2 species) |
Species Zymomonas mobilis [TaxId:542] [110420] (2 PDB entries) Uniprot Q9X5F2 |
Domain d1r0lb2: 1r0l B:3-126,B:265-290 [104739] Other proteins in same PDB: d1r0la1, d1r0la3, d1r0lb1, d1r0lb3, d1r0lc1, d1r0lc3, d1r0ld1, d1r0ld3 complexed with ndp |
PDB Entry: 1r0l (more details), 2.7 Å
SCOPe Domain Sequences for d1r0lb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r0lb2 c.2.1.3 (B:3-126,B:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} qprtvtvlgatgsighstldliernldryqvialtanrnvkdladaakrtnakraviadp slyndlkealagssveaaagadalveaammgadwtmaaiigcaglkatlaairkgktval ankeXdmrtpightlawpkrmetpaesldft
Timeline for d1r0lb2: