Lineage for d1r0kc2 (1r0k C:3-126,C:265-290)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2451891Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 2451892Protein 1-deoxy-D-xylulose-5-phosphate reductoisomerase [69410] (2 species)
  7. 2451919Species Zymomonas mobilis [TaxId:542] [110420] (2 PDB entries)
    Uniprot Q9X5F2
  8. 2451922Domain d1r0kc2: 1r0k C:3-126,C:265-290 [104730]
    Other proteins in same PDB: d1r0ka1, d1r0ka3, d1r0kb1, d1r0kb3, d1r0kc1, d1r0kc3, d1r0kd1, d1r0kd3
    complexed with act

Details for d1r0kc2

PDB Entry: 1r0k (more details), 1.91 Å

PDB Description: crystal structure of 1-deoxy-d-xylulose 5-phosphate reductoisomerase from zymomonas mobilis
PDB Compounds: (C:) 1-deoxy-D-xylulose 5-phosphate reductoisomerase

SCOPe Domain Sequences for d1r0kc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1r0kc2 c.2.1.3 (C:3-126,C:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]}
qprtvtvlgatgsighstldliernldryqvialtanrnvkdladaakrtnakraviadp
slyndlkealagssveaaagadalveaammgadwtmaaiigcaglkatlaairkgktval
ankeXdmrtpightlawpkrmetpaesldft

SCOPe Domain Coordinates for d1r0kc2:

Click to download the PDB-style file with coordinates for d1r0kc2.
(The format of our PDB-style files is described here.)

Timeline for d1r0kc2: