SCOP 1.73: Domain d1r0cg2: 1r0c G:151-310

Lineage for d1r0cg2 (1r0c G:151-310)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family)

5. Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (3 proteins)

6. Protein Aspartate carbamoyltransferase catalytic subunit [53673] (4 species)

7. Species Escherichia coli [TaxId:562] [53674] (45 PDB entries)

8. Domain d1r0cg2: 1r0c G:151-310 [104712]
   Other proteins in same PDB: d1r0cb1, d1r0cb2, d1r0ch1, d1r0ch2
   complexed with ips, ncd, zn

Details for d1r0cg2

PDB Entry: 1r0c, 2.37 Å

PDB Description: Products in the T State of Aspartate Transcarbamylase: Crystal Structure of the Phosphate and N-carbamyl-L-aspartate Ligated Enzyme

PDB Compounds: (G:) Aspartate carbamoyltransferase catalytic chain

SCOP Domain Sequences for d1r0cg2:

Sequence; same for both SEQRES and ATOM records:

>d1r0cg2 c.78.1.1 (G:151-310) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
rldnlhvamvgdlkygrtvhsltqalakfdgnrfyfiapdalampqyildmldekgiaws
lhssieevmaevdilymtrvqkerldpseyanvkaqfvlrasdlhnakanmkvlhplprv
deiatdvdktphawyfqqagngifarqallalvlnrdlvl

Timeline for d1r0cg2:

• d1r0cg2 first appeared in SCOP 1.69
  
• d1r0cg2 appears in SCOP 1.71
  
• d1r0cg2 appears in SCOP 1.75
  
• d1r0cg2 appears in the current release, SCOPe 2.08