Class a: All alpha proteins [46456] (258 folds) |
Fold a.25: Ferritin-like [47239] (4 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (5 families) contains bimetal-ion centre in the middle of the bundle |
Family a.25.1.1: Ferritin [47241] (9 proteins) |
Protein (Apo)ferritin [47246] (7 species) |
Species Human (Homo sapiens), mitocondial isoform [TaxId:9606] [109785] (1 PDB entry) |
Domain d1r03a_: 1r03 A: [104675] complexed with mo1, mo2, mo4, mo6 |
PDB Entry: 1r03 (more details), 1.7 Å
SCOP Domain Sequences for d1r03a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r03a_ a.25.1.1 (A:) (Apo)ferritin {Human (Homo sapiens), mitocondial isoform [TaxId: 9606]} srvrqnfhpdseaainrqinlelyasyvylsmayyfsrddvalnnfsryflhqsreeteh aeklmrlqnqrggrirlqdikkpeqddwesglhamecallleknvnqsllelhalasdkg dphlcdfletyylneqvksikelgdhvhnlvkmgapdaglaeylfdthtlg
Timeline for d1r03a_: