PDB entry 1r03

View 1r03 on RCSB PDB site
Description: crystal structure of a human mitochondrial ferritin
Class: metal binding protein
Keywords: iron storage; ferritin; x-ray crystallography
Deposited on 2003-09-19, released 2004-06-29
The last revision prior to the SCOP 1.73 freeze date was dated 2004-06-29, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.17
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mitochondrial ferritin
    Species: HOMO SAPIENS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1r03a_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1r03A (A:)
    paagpsrvrqnfhpdseaainrqinlelyasyvylsmayyfsrddvalnnfsryflhqsr
    eetehaeklmrlqnqrggrirlqdikkpeqddwesglhamecallleknvnqsllelhal
    asdkgdphlcdfletyylneqvksikelgdhvhnlvkmgapdaglaeylfdthtlgnenk
    qn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1r03A (A:)
    srvrqnfhpdseaainrqinlelyasyvylsmayyfsrddvalnnfsryflhqsreeteh
    aeklmrlqnqrggrirlqdikkpeqddwesglhamecallleknvnqsllelhalasdkg
    dphlcdfletyylneqvksikelgdhvhnlvkmgapdaglaeylfdthtlg