Lineage for d1q0qa2 (1q0q A:1-125,A:275-300)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1578283Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 1578284Protein 1-deoxy-D-xylulose-5-phosphate reductoisomerase [69410] (2 species)
  7. 1578285Species Escherichia coli [TaxId:562] [69411] (11 PDB entries)
    Uniprot P45568
  8. 1578286Domain d1q0qa2: 1q0q A:1-125,A:275-300 [104465]
    Other proteins in same PDB: d1q0qa1, d1q0qa3, d1q0qb1, d1q0qb3
    complexed with dxp, ndp

Details for d1q0qa2

PDB Entry: 1q0q (more details), 1.9 Å

PDB Description: crystal structure of dxr in complex with the substrate 1-deoxy-d- xylulose-5-phosphate
PDB Compounds: (A:) 1-deoxy-D-xylulose 5-phosphate reductoisomerase

SCOPe Domain Sequences for d1q0qa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]}
mkqltilgstgsigcstldvvrhnpehfrvvalvagknvtrmveqclefspryavmddea
sakllktmlqqqgsrtevlsgqqaacdmaaledvdqvmaaivgaagllptlaairagkti
llankXdmrtpiahtmawpnrvnsgvkpldfc

SCOPe Domain Coordinates for d1q0qa2:

Click to download the PDB-style file with coordinates for d1q0qa2.
(The format of our PDB-style files is described here.)

Timeline for d1q0qa2: